Recombinant Human CAMK2N1 protein, His-Trx-tagged

Cat.No. : CAMK2N1-2626H
Product Overview : Recombinant Human CAMK2N1 protein(Q7Z7J9)(1-78aa), fused to N-terminal His tag and Trx tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His&Trx
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 25.6 kDa
Protein length : 1-78aa
AA Sequence : MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CAMK2N1 calcium/calmodulin-dependent protein kinase II inhibitor 1 [ Homo sapiens ]
Official Symbol CAMK2N1
Synonyms PRO1489; RP11-401M16.1; calcium/calmodulin-dependent protein kinase II inhibitor 1; CaMKIINalpha; CAMK2N1
Gene ID 55450
mRNA Refseq NM_018584.5
Protein Refseq NP_061054.2
UniProt ID Q7Z7J9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CAMK2N1 Products

Required fields are marked with *

My Review for All CAMK2N1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon