Recombinant Human CAMK2N1 protein, His-Trx-tagged

• Cat.No.: CAMK2N1-2626H
• Product Overview: Recombinant Human CAMK2N1 protein(Q7Z7J9)(1-78aa), fused to N-terminal His tag and Trx tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&Trx
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.6 kDa
• Protein length: 1-78aa
• AA Sequence: MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CAMK2N1 calcium/calmodulin-dependent protein kinase II inhibitor 1 [ Homo sapiens ]
• Official Symbol: CAMK2N1
• Synonyms: PRO1489; RP11-401M16.1; calcium/calmodulin-dependent protein kinase II inhibitor 1; CaMKIINalpha; CAMK2N1
• Gene ID: 55450
• mRNA Refseq: NM_018584.5
• Protein Refseq: NP_061054.2
• UniProt ID: Q7Z7J9