Recombinant Mouse C3 protein, His-SUMO-tagged

• Cat.No.: C3-4246M
• Product Overview: Recombinant Mouse C3 protein(P01027)(1321-1663aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Mouse
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 55.3 kDa
• Protein length: 1321-1663aa
• AA Sequence: SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: C3 complement component 3 [ Mus musculus ]
• Official Symbol: C3
• Synonyms: C3; complement component 3; complement C3; complement factor 3; complement component 3d; acylation stimulating protein; ASP; Plp; HSE-MSF; AI255234
• Gene ID: 12266
• mRNA Refseq: NM_009778
• Protein Refseq: NP_033908