Recombinant Mouse BMP3 Protein (359-468 aa), His-tagged

• Cat.No.: BMP3-2588M
• Product Overview: Recombinant Mouse BMP3 Protein (359-468 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the C-terminal. Research Area: Developmental Biology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 359-468 aa
• Description: Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 14.4 kDa
• AA Sequence: QWVEPRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Bmp3 bone morphogenetic protein 3 [ Mus musculus ]
• Official Symbol: BMP3
• Synonyms: BMP3; bone morphogenetic protein 3
• Gene ID: 12158
• UniProt ID: Q8BHE5