Recombinant Human BMP3 Protein (363-472 aa), His-Myc-tagged
Cat.No. : | BMP3-2545H |
Product Overview : | Recombinant Human BMP3 Protein (363-472 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Developmental Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 363-472 aa |
Description : | Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.4 kDa |
AA Sequence : | QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | BMP3 bone morphogenetic protein 3 [ Homo sapiens ] |
Official Symbol | BMP3 |
Synonyms | BMP3; bone morphogenetic protein 3; osteogenin; BMP-3; bone morphogenetic protein-3; BMP-3A; |
Gene ID | 651 |
mRNA Refseq | NM_001201 |
Protein Refseq | NP_001192 |
MIM | 112263 |
UniProt ID | P12645 |
◆ Recombinant Proteins | ||
BMP3-012H | Active Recombinant Human BMP3 Protein | +Inquiry |
BMP3-256B | Recombinant Bovine BMP3 Protein, His-tagged | +Inquiry |
BMP3-4846Z | Recombinant Zebrafish BMP3 | +Inquiry |
BMP3-3377M | Recombinant Mouse BMP3 protein, His-tagged | +Inquiry |
BMP3-2598H | Recombinant Human BMP3 protein, Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP3-8433HCL | Recombinant Human BMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP3 Products
Required fields are marked with *
My Review for All BMP3 Products
Required fields are marked with *
0
Inquiry Basket