Recombinant Mouse Birc5 protein, His-SUMO-tagged

• Cat.No.: Birc5-2594M
• Product Overview: Recombinant Mouse Birc5 protein(O70201)(1-140aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-140aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.3 kDa
• AA Sequence: MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Birc5 baculoviral IAP repeat-containing 5 [ Mus musculus ]
• Official Symbol: Birc5
• Synonyms: BIRC5; baculoviral IAP repeat-containing 5; baculoviral IAP repeat-containing protein 5; survivin; apoptosis inhibitor 4; apoptosis inhibitor survivin; Api4; TIAP; AAC-11; survivin40
• Gene ID: 11799
• mRNA Refseq: NM_001012273
• Protein Refseq: NP_001012273