Recombinant Human BIRC5 protein(41-130 aa), C-His-tagged

• Cat.No.: BIRC5-2464H
• Product Overview: Recombinant Human BIRC5 protein(O15392)(41-130 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 41-130 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: AGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKK

Gene Information

• Gene Name: BIRC5 baculoviral IAP repeat containing 5 [ Homo sapiens ]
• Official Symbol: BIRC5
• Synonyms: BIRC5; baculoviral IAP repeat containing 5; API4, apoptosis inhibitor 4 , baculoviral IAP repeat containing 5; baculoviral IAP repeat-containing protein 5; EPR 1; survivin; survivin variant 3 alpha; apoptosis inhibitor 4; apoptosis inhibitor survivin; API4; EPR-1
• Gene ID: 332
• mRNA Refseq: NM_001012270
• Protein Refseq: NP_001012270
• MIM: 603352
• UniProt ID: O15392