Recombinant Mouse BIRC5 Protein, His-tagged

• Cat.No.: BIRC5-17M
• Product Overview: Recombinant Mouse BIRC5 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. In humans, gene expression is high during fetal development and in most tumors yet low in adult tissues. Antisense transcripts have been identified in human that regulate this gene's expression. At least three transcript variants encoding distinct isoforms have been found for this gene, although at least one of these transcript variants is a nonsense-mediated decay (NMD) candidate.
• Form: Lyophilized from sterile PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin 300.
• Molecular Mass: 17.25 kDa
• AA Sequence: MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAAMHHHHHH
• Endotoxin: ＜1EU/ug
• Purity: ＞90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: Birc5 baculoviral IAP repeat-containing 5 [ Mus musculus (house mouse) ]
• Official Symbol: Birc5
• Synonyms: Api4; TIAP; AAC-11; survivin40
• Gene ID: 11799
• mRNA Refseq: NM_009689
• Protein Refseq: NP_033819
• MIM: 603352
• UniProt ID: O70201