Recombinant Mouse Bgn protein, His-tagged
Cat.No. : | Bgn-2591M |
Product Overview : | Recombinant Mouse Bgn protein(P28653)(38-369aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 38-369aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.4 kDa |
AA Sequence : | DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Bgn biglycan [ Mus musculus ] |
Official Symbol | Bgn |
Synonyms | BGN; biglycan; bone/cartilage proteoglycan I; BG; PGI; DSPG1; PG-S1; SLRR1A; |
Gene ID | 12111 |
mRNA Refseq | NM_007542 |
Protein Refseq | NP_031568 |
◆ Recombinant Proteins | ||
BGN-7544H | Recombinant Human BGN, His-tagged | +Inquiry |
BGN-43H | Recombinant Human BGN, His-tagged | +Inquiry |
BGN-533M | Recombinant Mouse Bgn, Fc tagged | +Inquiry |
Bgn-01M | Active Recombinant Mouse Bgn Protein (Asp38-Lys369), C-6×His tagged | +Inquiry |
Bgn-2591M | Recombinant Mouse Bgn protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BGN-1124MCL | Recombinant Mouse BGN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Bgn Products
Required fields are marked with *
My Review for All Bgn Products
Required fields are marked with *
0
Inquiry Basket