Recombinant mouse beta-2 microglobulin protein, Fc-tagged
Cat.No. : | B2m-01H |
Product Overview : | Recombinant mouse beta-2 microglobulin protein with N-terminal Fc fusion tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system. |
Source : | E. coli |
Species : | Mouse |
Tag : | Fc |
Form : | Buffered aqueous solution |
Molecular Mass : | 37.1 kDa |
Protein length : | 326 |
AA Sequence : | DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM |
Purity : | >90% by SDS-PAGE |
Applications : | Antigen for antibody production ELISA Kinetics |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.19 mg/ml |
Storage Buffer : | Solution in 50mM Tris-HCl, 300mM NaCl, pH 8.5. |
Gene Name | B2m |
Official Symbol | B2m |
Synonyms | Ly-m11, beta 2 microglobulin, beta2-m |
Gene ID | 12010 |
mRNA Refseq | NM_009735.3 |
Protein Refseq | NP_033865.2 |
UniProt ID | P01887 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B2m Products
Required fields are marked with *
My Review for All B2m Products
Required fields are marked with *
0
Inquiry Basket