Recombinant Mouse Atp1b1 Full Length Transmembrane protein, His-tagged

• Cat.No.: Atp1b1-1309M
• Product Overview: Recombinant Mouse Atp1b1 protein(P14094)(1-304aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Source: In vitro E. coli expression system
• Species: Mouse
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Protein length: 1-304aa
• AA Sequence: MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS-
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Atp1b1 ATPase, Na+/K+ transporting, beta 1 polypeptide [ Mus musculus ]
• Official Symbol: Atp1b1
• Synonyms: ATP1B1; ATPase, Na+/K+ transporting, beta 1 polypeptide; sodium/potassium-transporting ATPase subunit beta-1; sodium/potassium ATPase beta subunit; sodium/potassium-dependent ATPase subunit beta-1; Atpb; Atpb-1
• Gene ID: 11931
• mRNA Refseq: NM_009721
• Protein Refseq: NP_033851