Recombinant Full Length Dog Sodium/Potassium-Transporting Atpase Subunit Beta-1(Atp1B1) Protein, His-Tagged
Cat.No. : | RFL-11841CF |
Product Overview : | Recombinant Full Length Dog Sodium/potassium-transporting ATPase subunit beta-1(ATP1B1) Protein (P06583) (1-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-303) |
Form : | Lyophilized powder |
AA Sequence : | MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEEYVRNIVRFLEKYKDSAQKDEMIFEDCGNMPSEIKERGEFNNERGERKVCRFKLEWLGNCSGINDETYGYRDGKPCVLIKLNRVLGFKPKPPKNESLEAYPVMKYSPYVLPVQCTGKRDEDKDRIGNVEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATP1B1 |
Synonyms | ATP1B1; Sodium/potassium-transporting ATPase subunit beta-1; Sodium/potassium-dependent ATPase subunit beta-1 |
UniProt ID | P06583 |
◆ Recombinant Proteins | ||
ATP1B1-850M | Recombinant Mouse ATP1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Atp1b1-1309M | Recombinant Mouse Atp1b1 Full Length Transmembrane protein, His-tagged | +Inquiry |
ATP1B1-10007H | Recombinant Human ATP1B1, GST-tagged | +Inquiry |
RFL-19609TF | Recombinant Full Length Torpedo Californica Sodium/Potassium-Transporting Atpase Subunit Beta-1(Atp1B1) Protein, His-Tagged | +Inquiry |
ATP1B1-321C | Recombinant Cynomolgus ATP1B1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP1B1-919HCL | Recombinant Human ATP1B1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP1B1 Products
Required fields are marked with *
My Review for All ATP1B1 Products
Required fields are marked with *
0
Inquiry Basket