Recombinant Mouse Anxa5 Protein, His-tagged

• Cat.No.: Anxa5-7163M
• Product Overview: Recombinant mouse Anxa5, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-319
• Description: This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
• Form: Liquid
• Molecular Mass: 38.1 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSPMGSMATRGTVTDFPGFDGRADAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by bradford assay)
• Storage Buffer: Phosphate Buffered Saline containing 10 % glycerol, 1 mM DTT.

Gene Information

• Gene Name: Anxa5 annexin A5 [ Mus musculus (house mouse) ]
• Official Symbol: Anxa5
• Synonyms: Anxa5; annexin A5; An; Anx5; R74653; annexin A5; CBP-I; PAP-I; PP4; VAC-alpha; anchorin CII; annexin V; annexin-5; calphobindin I; endonexin II; lipocortin V; placental anticoagulant protein 4; placental anticoagulant protein I; thromboplastin inhibitor; vascular anticoagulant-alpha
• Gene ID: 11747
• mRNA Refseq: NM_009673
• Protein Refseq: NP_033803
• UniProt ID: P48036