Recombinant Chicken ANXA5 Protein tagged
| Cat.No. : | ANXA5-01C |
| Product Overview : | The Chicken Annexin V recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | Yeast |
| Description : | Collagen-binding protein. |
| Molecular Mass : | 36.1 kDa |
| AA Sequence : | MAKYTRGTVTAFSPFDARADAEALRKAMKGMGTDEETILKILTSRNNAQRQEIASAFKTLFGRDLVDDLKSELTGKFETLMVSLMRPARIFDAHALKHAIKGAGTNEKVLTEILASRTPAEVQNIKQVYMQEYEANLEDKITGETSGHFQRLLVVLLQAN |
| Gene Name | ANXA5 annexin A5 [ Gallus gallus (chicken) ] |
| Official Symbol | ANXA5 |
| Synonyms | ANXA5; annexin A5; ANX5; annexin A5; CBP-I; PAP-I; VAC-alpha; anchorin CII; annexin V; annexin-5; calphobindin I; endonexin II; lipocortin V; placental anticoagulant protein I; thromboplastin inhibitor; vascular anticoagulant-alpha |
| Gene ID | 428767 |
| mRNA Refseq | NM_001031538 |
| Protein Refseq | NP_001026709 |
| UniProt ID | P17153 |
| ◆ Recombinant Proteins | ||
| ANXA5-169H | Recombinant Human ANXA5 Protein, His-tagged | +Inquiry |
| Anxa5-7163M | Recombinant Mouse Anxa5 Protein, His-tagged | +Inquiry |
| ANXA5-0429H | Recombinant Human ANXA5 Protein (Met1-Asp320), N-His-tagged | +Inquiry |
| Anxa5-3497R | Recombinant Rat Anxa5, His-tagged | +Inquiry |
| ANXA5-6912H | Recombinant Human ANXA5 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANXA5-8830HCL | Recombinant Human ANXA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANXA5 Products
Required fields are marked with *
My Review for All ANXA5 Products
Required fields are marked with *
0
Inquiry Basket
