Recombinant Mouse Aicda protein, His&Myc-tagged
Cat.No. : | Aicda-2495M |
Product Overview : | Recombinant Mouse Aicda protein(Q9WVE0)(1-198aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-198aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.5 kDa |
AA Sequence : | MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Aicda activation-induced cytidine deaminase [ Mus musculus ] |
Official Symbol | Aicda |
Synonyms | AICDA; activation-induced cytidine deaminase; cytidine aminohydrolase; activation induced deaminase; Aid; Arp2; |
Gene ID | 11628 |
mRNA Refseq | NM_009645 |
Protein Refseq | NP_033775 |
◆ Recombinant Proteins | ||
Aicda-1248M | Recombinant Mouse Aicda protein, His-tagged | +Inquiry |
AICDA-409M | Recombinant Mouse AICDA Protein, His (Fc)-Avi-tagged | +Inquiry |
AICDA-7113H | Recombinant Human AICDA, His-tagged | +Inquiry |
AICDA-9502H | Recombinant Human AICDA, His-tagged | +Inquiry |
AICDA-2783H | Recombinant Human AICDA Protein (1-198 aa), His-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AICDA-8958HCL | Recombinant Human AICDA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Aicda Products
Required fields are marked with *
My Review for All Aicda Products
Required fields are marked with *
0
Inquiry Basket