Recombinant Mouse Adamts13 protein, hFc-tagged

• Cat.No.: Adamts13-2322M
• Product Overview: Recombinant Mouse Adamts13 protein(Q769J6)(904-1137aa), fused with C-terminal hFc tag, was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Fc
• Protein Length: 904-1137aa
• Tag: C-hFc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 54.2 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA

Gene Information

• Gene Name: Adamts13 a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 13 [ Mus musculus ]
• Official Symbol: Adamts13
• Synonyms: ADAMTS13; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 13; A disintegrin and metalloproteinase with thrombospondin motifs 13; ADAM-TS13; ADAMTS-13; ADAM-TS 13; vWF-cleaving protease; ADAMTS13 isoform IAP-b; von Willebrand factor-cleaving protease; vWF-CP mRNA for von Willebrand factor-cleaving; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13; Gm710; vWF-CP
• Gene ID: 279028
• mRNA Refseq: NM_001001322
• Protein Refseq: NP_001001322