Recombinant Human ADAMTS13 Protein, GST-tagged

• Cat.No.: ADAMTS13-299H
• Product Overview: Human ADAMTS13 partial ORF ( NP_620594, 1328 a.a. - 1427 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of a family of proteins containing several distinct regions, including a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. The enzyme encoded by this gene specifically cleaves von Willebrand Factor (vWF). Defects in this gene are associated with thrombotic thrombocytopenic purpura. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAMTS13 ADAM metallopeptidase with thrombospondin type 1 motif, 13 [ Homo sapiens ]
• Official Symbol: ADAMTS13
• Synonyms: ADAMTS13; ADAM metallopeptidase with thrombospondin type 1 motif, 13; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 , C9orf8; A disintegrin and metalloproteinase with thrombospondin motifs 13; DKFZp434C2322; FLJ42993; MGC118899; MGC118900; TTP; vWF CP; VWFCP; ADAM-TS 13; vWF-cleaving protease; von Willebrand factor-cleaving protease; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13; 13; C9orf8; vWF-CP; ADAM-TS; ADAM-TS13; ADAMTS-13
• Gene ID: 11093
• mRNA Refseq: NM_139025
• Protein Refseq: NP_620594
• MIM: 604134
• UniProt ID: Q76LX8