Recombinant Human TIMP2 protein, T7/His-tagged

Cat.No. : TIMP2-152H
Product Overview : Recombinant human TIMP2 cDNA (27 – 220aa, derived from BC071586) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 27-220 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGECSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEI KQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRY QMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro TIMP2 mediated matrix metalloproteinases activities regulation study for cell differentiation or cancer cell metastasis with this protein either as soluble factor or as coating matrix protein.2. May be used for mapping TMP2 protein-protein interaction.3. Potential biomarker protein for diagnostic/prognosis, such as prostate or lung cancer.4. As immunogen for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name TIMP2 TIMP metallopeptidase inhibitor 2 [ Homo sapiens ]
Official Symbol TIMP2
Synonyms TIMP2; TIMP metallopeptidase inhibitor 2; tissue inhibitor of metalloproteinase 2; metalloproteinase inhibitor 2; CSC 21K; TIMP-2; tissue inhibitor of metalloproteinases 2; CSC-21K;
Gene ID 7077
mRNA Refseq NM_003255
Protein Refseq NP_003246
MIM 188825
UniProt ID P16035
Chromosome Location 17q25
Pathway Activation of Matrix Metalloproteinases, organism-specific biosystem; Degradation of the extracellular matrix, organism-specific biosystem; Extracellular matrix organization, organism-specific biosystem; Matrix Metalloproteinases, organism-specific biosystem;
Function enzyme activator activity; enzyme inhibitor activity; integrin binding; metal ion binding; metalloendopeptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TIMP2 Products

Required fields are marked with *

My Review for All TIMP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon