Recombinant Lolium perenne Major pollen allergen Lol p 5a Protein, His-SUMO/MYC-tagged
Cat.No. : | LOLPIB-1268L |
Product Overview : | Recombinant Lolium perenne Major pollen allergen Lol p 5a Protein (26-307aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lolium perenne |
Source : | E.coli |
Tag : | His&Myc&SUMO |
ProteinLength : | 26-307 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 48.4 kDa |
AA Sequence : | ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQSLISLLIYY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Major pollen allergen Lol p 5a |
Official Symbol | Major pollen allergen Lol p 5a |
Synonyms | Major pollen allergen Lol p 5a; Allergen Lol p Ib; Allergen Lol p Va; Lol p 5a |
UniProt ID | Q40240 |
◆ Recombinant Proteins | ||
Areg-242M | Recombinant Mouse Areg Protein, His-tagged | +Inquiry |
NAPRT-1471H | Recombinant Human NAPRT Protein, GST-tagged | +Inquiry |
BRD1-644H | Recombinant Human bromodomain containing 1, His-tagged | +Inquiry |
HSPA2-1605HFL | Recombinant Full Length Human HSPA2 Protein, C-Flag-tagged | +Inquiry |
TCEB2-5646R | Recombinant Rat TCEB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgG1-228H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
FABP3-27801TH | Native Human FABP3 protein | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
LDL-396H | Native Human Low Density Lipoprotein, DiI labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2367HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
CSK-628HCL | Recombinant Human CSK cell lysate | +Inquiry |
SERPINF2-2445HCL | Recombinant Human SERPINF2 cell lysate | +Inquiry |
FAM102B-6463HCL | Recombinant Human FAM102B 293 Cell Lysate | +Inquiry |
TMED1-1350HCL | Recombinant Human TMED1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Major pollen allergen Lol p 5a Products
Required fields are marked with *
My Review for All Major pollen allergen Lol p 5a Products
Required fields are marked with *
0
Inquiry Basket