Recombinant Human NAPRT Protein, GST-tagged

• Cat.No.: NAPRT-1471H
• Product Overview: Human NAPRT1 full-length ORF ( NP_660202.2, 1 a.a. - 466 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ expression system.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Nicotinic acid (NA; niacin) is converted by nicotinic acid phosphoribosyltransferase (NAPRT; EC 2.4.2.11) to NA mononucleotide (NaMN), which is then converted to NA adenine dinucleotide (NaAD), and finally to nicotinamide adenine dinucleotide (NAD), which serves as a coenzyme in cellular redox reactions and is an essential component of a variety of processes in cellular metabolism including response to stress.
• Molecular Mass: 76 kDa
• AA Sequence: MALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQVAAPPPSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NAPRT nicotinate phosphoribosyltransferase [ Homo sapiens (human) ]
• Official Symbol: NAPRT
• Synonyms: NAPRT; nicotinate phosphoribosyltransferase; NAPRT1; PP3856; nicotinate phosphoribosyltransferase; FHA-HIT-interacting protein; NAPRTase; nicotinate phosphoribosyltransferase domain containing 1; nicotinate phosphoribosyltransferase domain-containing protein 1; nicotinic acid phosphoribosyltransferase; EC 6.3.4.21
• Gene ID: 93100
• mRNA Refseq: NM_145201
• Protein Refseq: NP_660202
• MIM: 611552
• UniProt ID: Q6XQN6