Recombinant Klebsiella Pneumoniae BAMA Protein (24-172 aa), His-B2M-Myc-tagged

• Cat.No.: BAMA-2102K
• Product Overview: Recombinant Klebsiella Pneumoniae (strain 342) BAMA Protein (24-172 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-B2M tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.

Specification

• Species: Klebsiella Pneumoniae
• Source: E.coli
• Tag: His&Myc&B2M
• ProteinLength: 24-172 aa
• Description: Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 33.3 kDa
• AA Sequence: FVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: BamA
• UniProt ID: B5Y1J4