Recombinant Escherichia coli (strain K12 / MC4100 / BW2952) BamA protein, His&Myc-tagged
Cat.No. : | BamA-643E |
Product Overview : | Recombinant Escherichia coli (strain K12 / MC4100 / BW2952) BamA protein(C4ZRR9)(21-810aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | N-His&C-Myc |
ProteinLength : | 21-810aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 95.9 kDa |
AASequence : | AEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
NI36-RS03185-1084S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS03185 protein, His-tagged | +Inquiry |
F2-1356R | Recombinant Rhesus Macaque F2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HIST1H1A-4773H | Recombinant Human HIST1H1A Protein, GST-tagged | +Inquiry |
RFL7280HF | Recombinant Full Length Human Olfactory Receptor 5Ak2(Or5Ak2) Protein, His-Tagged | +Inquiry |
HHLA1-4155M | Recombinant Mouse HHLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
NEFL-181B | Native bovine NEFL | +Inquiry |
SERPINF2-27292TH | Native Human SERPINF2 | +Inquiry |
KRT19-169H | Native Human Cytokeratin 19 | +Inquiry |
Serpinc1-5485M | Native Mouse Serpin (or cysteine) Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
ITGB3-11H | Native Human GPIIbIIIa | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTC-2505MCL | Recombinant Mouse BTC cell lysate | +Inquiry |
CHST12-7507HCL | Recombinant Human CHST12 293 Cell Lysate | +Inquiry |
UBL3-555HCL | Recombinant Human UBL3 293 Cell Lysate | +Inquiry |
Brain-85M | Mouse Brain Tissue Lysate (14 Days Old) | +Inquiry |
USP45-453HCL | Recombinant Human USP45 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BamA Products
Required fields are marked with *
My Review for All BamA Products
Required fields are marked with *
0
Inquiry Basket