Recombinant Human ZNRF3 Protein (56-219 aa), His-SUMO-tagged
Cat.No. : | ZNRF3-1910H |
Product Overview : | Recombinant Human ZNRF3 Protein (56-219 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 56-219 aa |
Description : | E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 34.2 kDa |
AA Sequence : | KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | ZNRF3 zinc and ring finger 3 [ Homo sapiens ] |
Official Symbol | ZNRF3 |
Synonyms | RNF203; BK747E2.3; |
Gene ID | 84133 |
mRNA Refseq | NM_032173.3 |
Protein Refseq | NP_115549.2 |
MIM | 612062 |
UniProt ID | Q9ULT6 |
◆ Recombinant Proteins | ||
ZNRF3-2111H | Active Recombinant Human ZNRF3 protein, His-tagged | +Inquiry |
ZNRF3-1523H | Recombinant Human ZNRF3 protein, His-tagged | +Inquiry |
ZNRF3-1524H | Recombinant Human ZNRF3 protein, His-tagged | +Inquiry |
ZNRF3-4636H | Recombinant Human ZNRF3 protein | +Inquiry |
Znrf3-33M | Active Recombinant Mouse zinc and ring finger 3 protein, Fc tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNRF3 Products
Required fields are marked with *
My Review for All ZNRF3 Products
Required fields are marked with *
0
Inquiry Basket