Recombinant Human ZNRF3 protein

• Cat.No.: ZNRF3-4636H
• Product Overview: Recombinant Human ZNRF3 protein(Q9ULT6)(56-219aa) was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: Non
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.2 kDa
• Protein length: 56-219aa
• AA Sequence: KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: ZNRF3 zinc and ring finger 3 [ Homo sapiens ]
• Official Symbol: ZNRF3
• Synonyms: RNF203; BK747E2.3
• Gene ID: 84133
• mRNA Refseq: NM_032173.3
• Protein Refseq: NP_115549.2
• MIM: 612062
• UniProt ID: Q9ULT6