Recombinant Human ZNF839 protein, His-tagged

Cat.No. : ZNF839-3878H
Product Overview : Recombinant Human ZNF839 protein(NP_060805)(514-643 aa), fused with His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 514-643 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : FPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAG
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ZNF839 zinc finger protein 839 [ Homo sapiens ]
Official Symbol ZNF839
Synonyms ZNF839; zinc finger protein 839; C14orf131, chromosome 14 open reading frame 131; renal carcinoma antigen NY-REN-50; C14orf131; FLJ11132;
Gene ID 55778
mRNA Refseq NM_018335
Protein Refseq NP_060805
UniProt ID A8K0R7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZNF839 Products

Required fields are marked with *

My Review for All ZNF839 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon