Recombinant Human ZNF580 protein, GST-tagged
Cat.No. : | ZNF580-301169H |
Product Overview : | Recombinant Human ZNF580 (1-124 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Ala124 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ZNF580 zinc finger protein 580 [ Homo sapiens ] |
Official Symbol | ZNF580 |
Synonyms | ZNF580; zinc finger protein 580; LDL induced EC protein; LDL-induced EC protein; |
Gene ID | 51157 |
mRNA Refseq | NM_001163423 |
Protein Refseq | NP_001156895 |
UniProt ID | Q9UK33 |
◆ Recombinant Proteins | ||
ZNF580-3273H | Recombinant Human ZNF580 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZNF580-301169H | Recombinant Human ZNF580 protein, GST-tagged | +Inquiry |
ZNF580-10446M | Recombinant Mouse ZNF580 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZFP580-18989M | Recombinant Mouse ZFP580 Protein | +Inquiry |
ZNF580-1502H | Recombinant Human ZNF580 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF580-44HCL | Recombinant Human ZNF580 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNF580 Products
Required fields are marked with *
My Review for All ZNF580 Products
Required fields are marked with *
0
Inquiry Basket