Recombinant Human ZNF460 protein, GST-tagged

• Cat.No.: ZNF460-3851H
• Product Overview: Recombinant Human ZNF460 protein(102-211 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 102-211 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MQEYFLRPGTDPQSEKLHGKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKHL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: ZNF460
• Synonyms: ZNF460; zinc finger protein 460; zinc finger protein 272 , ZNF272; HZF8; zinc finger protein 272; zinc finger protein HZF8; ZNF272
• Gene ID: 10794
• mRNA Refseq: NM_006635
• Protein Refseq: NP_006626
• MIM: 604755
• UniProt ID: Q14592