Recombinant Human ZNF395 protein, T7-tagged

Cat.No. : ZNF395-170H
Product Overview : Recombinant human ZNF395 (513 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 513 a.a.
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFASVLSRRLGKRSLLGARVLGPSASEGPSAAPPSEPLLEGAAPQPFTTSDDTPCQEQPKEV LKAPSTSGLQQVAFQPGQKVYVWYGGQECTGLVEQHSWMEGQVTVWLLEQKLQVCCRVEEVWLAELQGPCPQAPP LEPGAQALAYRPVSRNIDVPKRKSDAVEMDEMMAAMVLTSLSCSPVVQSPPGTEANFSASRAACDPWKESGDISD SGSSTTSGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMYKCLWPN CGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAAAGTPVPGTPTSEPAPTPSMTG LPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPVSPHIYTSVSWAAAPSA ACSLSPVRSRSLSFSEPQQPAPAMKSHLIVTSPPRAQSGARKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRF LD
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro mSIN3A-HDAC1 complex regulations study using recombinant ZNF395 protein intracellular delivery method.2. May be used as enzymatic substrate protein for Kinase and ubiquitin assay.3. May be used for mapping ZNF395 protein binding partner in protein–protein interaction assay in B cells.4. May be used as antigen for specific antibody development.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name ZNF395 zinc finger protein 395 [ Homo sapiens ]
Official Symbol ZNF395
Synonyms ZNF395; zinc finger protein 395; DKFZp434K1210; HDBP2; PBF; PRF 1; HD-regulating factor 2; papillomavirus-binding factor; papillomavirus regulatory factor 1; papillomavirus regulatory factor PRF-1; HD gene regulatory region-binding protein 2; huntington disease gene regulatory region-binding protein 2; Huntingtons disease gene regulatory region-binding protein 2; PRF1; PRF-1; HDBP-2; HDRF-2; Si-1-8-14;
Gene ID 55893
mRNA Refseq NM_018660
Protein Refseq NP_061130
MIM 609494
UniProt ID Q9H8N7
Chromosome Location 8p21
Function DNA binding; metal ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZNF395 Products

Required fields are marked with *

My Review for All ZNF395 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon