Recombinant Human ZNF143 protein, His-tagged

• Cat.No.: ZNF143-3138H
• Product Overview: Recombinant Human ZNF143 protein(428-590 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His
• Protein length: 428-590 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: HNDTEPIEEEQEAFFEPPPGQGEDVLKGSQITYVTGVEGDDVVSTQVATVTQSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGTHSVAMVTAEGTEGQQVAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVAT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ZNF143 zinc finger protein 143 [ Homo sapiens ]
• Official Symbol: ZNF143
• Synonyms: ZNF143; zinc finger protein 143; zinc finger protein 143 (clone pHZ 1); pHZ 1; SBF; STAF; hStaf; SPH-binding factor; transcriptional activator Staf; selenocysteine tRNA gene transcription-activating factor; pHZ-1
• Gene ID: 7702
• mRNA Refseq: NM_003442
• Protein Refseq: NP_003433
• MIM: 603433
• UniProt ID: P52747