Recombinant Human ZNF143 protein, GST-tagged

• Cat.No.: ZNF143-301583H
• Product Overview: Recombinant Human ZNF143 (428-590 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: His428-Thr590
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: HNDTEPIEEEQEAFFEPPPGQGEDVLKGSQITYVTGVEGDDVVSTQVATVTQSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGTHSVAMVTAEGTEGQQVAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVAT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: ZNF143 zinc finger protein 143 [ Homo sapiens ]
• Official Symbol: ZNF143
• Synonyms: ZNF143; zinc finger protein 143; zinc finger protein 143 (clone pHZ 1); pHZ 1; SBF; STAF; hStaf; SPH-binding factor; transcriptional activator Staf; selenocysteine tRNA gene transcription-activating factor; pHZ-1
• Gene ID: 7702
• mRNA Refseq: NM_003442
• Protein Refseq: NP_003433
• MIM: 603433
• UniProt ID: P52747