Recombinant Human ZNF143 protein, GST-tagged

Cat.No. : ZNF143-301583H
Product Overview : Recombinant Human ZNF143 (428-590 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : His428-Thr590
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : HNDTEPIEEEQEAFFEPPPGQGEDVLKGSQITYVTGVEGDDVVSTQVATVTQSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGTHSVAMVTAEGTEGQQVAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVAT
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name ZNF143 zinc finger protein 143 [ Homo sapiens ]
Official Symbol ZNF143
Synonyms ZNF143; zinc finger protein 143; zinc finger protein 143 (clone pHZ 1); pHZ 1; SBF; STAF; hStaf; SPH-binding factor; transcriptional activator Staf; selenocysteine tRNA gene transcription-activating factor; pHZ-1;
Gene ID 7702
mRNA Refseq NM_003442
Protein Refseq NP_003433
MIM 603433
UniProt ID P52747

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZNF143 Products

Required fields are marked with *

My Review for All ZNF143 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon