Recombinant Human ZNF143 protein, His-tagged
Cat.No. : | ZNF143-3818H |
Product Overview : | Recombinant Human ZNF143 protein(283-626 aa), fused with N-terminal His tag, was expressed in E. coli. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | N-His |
Protein length : | 283-626 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AASequence : | KPYRCSEDNCTKSFKTSGDLQKHIRTHTGERPFKCPFEGCGRSFTTSNIRKVHVRTHTGERPYYCTEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNHCGKTYKQISTLVMHKRTAHNDTEPIEEEQEAFFEPPPGQGEDVLKGSQITYVTGVEGDDVVSTQVATVTQSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGTHSVAMVTAEGTEGQQVAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQLGEQPSLEEAIRIASRIQQGETPGLDD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | ZNF143 zinc finger protein 143 [ Homo sapiens ] |
Official Symbol | ZNF143 |
Synonyms | ZNF143; zinc finger protein 143; zinc finger protein 143 (clone pHZ 1); pHZ 1; SBF; STAF; hStaf; SPH-binding factor; transcriptional activator Staf; selenocysteine tRNA gene transcription-activating factor; pHZ-1; |
Gene ID | 7702 |
mRNA Refseq | NM_003442 |
Protein Refseq | NP_003433 |
MIM | 603433 |
UniProt ID | P52747 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ZNF143 Products
Required fields are marked with *
My Review for All ZNF143 Products
Required fields are marked with *
0
Inquiry Basket