Recombinant Human ZFP36L1 protein, GST-tagged

• Cat.No.: ZFP36L1-3801H
• Product Overview: Recombinant Human ZFP36L1(1 a.a. - 108 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1-108 a.a.
• Description: This gene is a member of the TIS11 family of early response genes, which are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. This gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.62 kDa
• AA Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEP APALSSRDSRFRDRSFSEGGERLLPTQKQPGGG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: ZFP36L1 zinc finger protein 36, C3H type-like 1 [ Homo sapiens ]
• Official Symbol: ZFP36L1
• Synonyms: ZFP36L1; zinc finger protein 36, C3H type-like 1; BRF1, zinc finger protein, C3H type, 36 like 1; zinc finger protein 36, C3H1 type-like 1; Berg36; cMG1; ERF1; RNF162B; TIS11B; EGF-response factor 1; butyrate response factor 1; early response factor Berg36; zinc finger protein, C3H type, 36-like 1; BRF1; ERF-1
• Gene ID: 677
• mRNA Refseq: NM_004926
• Protein Refseq: NP_004917
• MIM: 601064
• UniProt ID: Q07352
• Chromosome Location: 14q22-q24
• Pathway: Destabilization of mRNA by Butyrate Response Factor 1 (BRF1), organism-specific biosystem; Gene Expression, organism-specific biosystem; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements, organism-specific biosystem; Validated targets of C-MYC transcriptional repression, organism-specific biosystem
• Function: AU-rich element binding; DNA binding; mRNA binding; metal ion binding; protein binding; sequence-specific DNA binding transcription factor activity; zinc ion binding