Recombinant Human ZEB1 Protein, GST-tagged

Cat.No. : ZEB1-22H
Product Overview : Recombinant Human ZEB1(801 a.a. - 900 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 801 a.a. - 900 a.a.
Description : This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
Applications : Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name ZEB1 zinc finger E-box binding homeobox 1 [ Homo sapiens ]
Official Symbol ZEB1
Synonyms ZEB1; zinc finger E-box binding homeobox 1; posterior polymorphous corneal dystrophy 3 , PPCD3, TCF8, transcription factor 8 (represses interleukin 2 expression); zinc finger E-box-binding homeobox 1; AREB6; BZP; NIL 2 A; ZEB; Zfhep; Zfhx1a; negative regulator of IL2; delta-crystallin enhancer binding factor 1; posterior polymorphous corneal dystrophy 3; zinc finger homeodomain enhancer-binding protein; transcription factor 8 (represses interleukin 2 expression); TCF8; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1; MGC133261;
Gene ID 6935
mRNA Refseq NM_001128128
Protein Refseq NP_001121600
MIM 189909
UniProt ID P37275

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZEB1 Products

Required fields are marked with *

My Review for All ZEB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon