Recombinant Human ZEB1 Protein, GST-tagged
Cat.No. : | ZEB1-22H |
Product Overview : | Recombinant Human ZEB1(801 a.a. - 900 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 801 a.a. - 900 a.a. |
Description : | This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE |
Applications : | Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ZEB1 zinc finger E-box binding homeobox 1 [ Homo sapiens ] |
Official Symbol | ZEB1 |
Synonyms | ZEB1; zinc finger E-box binding homeobox 1; posterior polymorphous corneal dystrophy 3 , PPCD3, TCF8, transcription factor 8 (represses interleukin 2 expression); zinc finger E-box-binding homeobox 1; AREB6; BZP; NIL 2 A; ZEB; Zfhep; Zfhx1a; negative regulator of IL2; delta-crystallin enhancer binding factor 1; posterior polymorphous corneal dystrophy 3; zinc finger homeodomain enhancer-binding protein; transcription factor 8 (represses interleukin 2 expression); TCF8; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1; MGC133261; |
Gene ID | 6935 |
mRNA Refseq | NM_001128128 |
Protein Refseq | NP_001121600 |
MIM | 189909 |
UniProt ID | P37275 |
◆ Recombinant Proteins | ||
ZEB1-6688C | Recombinant Chicken ZEB1 | +Inquiry |
ZEB1-604H | Recombinant Human ZEB1 Protein, His-tagged | +Inquiry |
ZEB1-10324M | Recombinant Mouse ZEB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZEB1-3796H | Recombinant Human ZEB1, GST-tagged | +Inquiry |
ZEB1-22H | Recombinant Human ZEB1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZEB1-190HCL | Recombinant Human ZEB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZEB1 Products
Required fields are marked with *
My Review for All ZEB1 Products
Required fields are marked with *
0
Inquiry Basket