Recombinant Human ZDHHC20 protein, GST-tagged

• Cat.No.: ZDHHC20
• Product Overview: Recombinant Human ZDHHC20 (79-153 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ser79-Asp153
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: SPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMD
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: ZDHHC20 zinc finger, DHHC-type containing 20 [ Homo sapiens ]
• Official Symbol: ZDHHC20
• Synonyms: ZDHHC20; zinc finger, DHHC-type containing 20; probable palmitoyltransferase ZDHHC20; FLJ25952; DHHC-20; 4933421L13Rik; DHHC-containing protein 20; zinc finger, DHHC domain containing 20; zinc finger DHHC domain-containing protein 20; MGC126005
• Gene ID: 253832
• mRNA Refseq: NM_153251
• Protein Refseq: NP_694983
• UniProt ID: Q5W0Z9