Recombinant Human ZDHHC20 protein, His-tagged

• Cat.No.: ZDHHC20-3459H
• Product Overview: Recombinant Human ZDHHC20 protein(79-153 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 79-153 aa
• AA Sequence: SPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMD
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ZDHHC20 zinc finger, DHHC-type containing 20 [ Homo sapiens ]
• Official Symbol: ZDHHC20
• Synonyms: ZDHHC20; zinc finger, DHHC-type containing 20; probable palmitoyltransferase ZDHHC20; FLJ25952; DHHC-20; 4933421L13Rik; DHHC-containing protein 20; zinc finger, DHHC domain containing 20; zinc finger DHHC domain-containing protein 20; MGC126005
• Gene ID: 253832
• mRNA Refseq: NM_153251
• Protein Refseq: NP_694983
• UniProt ID: Q5W0Z9