Recombinant Human ZCCHC17 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZCCHC17-6036H
• Product Overview: ZCCHC17 MS Standard C13 and N15-labeled recombinant protein (NP_057589) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: ZCCHC17 (Zinc Finger CCHC-Type Containing 17) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleic acid binding.
• Molecular Mass: 27.6 kDa
• AA Sequence: MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKKKKHKKKHKETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZCCHC17 zinc finger CCHC-type containing 17 [ Homo sapiens (human) ]
• Official Symbol: ZCCHC17
• Synonyms: ZCCHC17; zinc finger, CCHC domain containing 17; nucleolar protein of 40 kDa; HSPC251; pNO40; PS1D; nucleolar protein 40; pnn-interacting nucleolar protein; putative S1 RNA binding domain protein; putative S1 RNA-binding domain protein; zinc finger CCHC domain-containing protein 17; RP11-266K22.1
• Gene ID: 51538
• mRNA Refseq: NM_016505
• Protein Refseq: NP_057589
• UniProt ID: Q9NP64