Recombinant Human ZCCHC17, His-tagged
Cat.No. : | ZCCHC17-31652TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-241 of Human ZCCHC17 with N terminal His tag; MWt 34kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 1-241 a.a. |
Description : | ZCCHC17, also known as pNO40 or PS1D, is a 241 amino acid protein that interacts with both Pinin and the 60S ribosomal subunit. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 123 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRK QGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKN DRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQ DYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTK YSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKK KKHKKKHKE |
Sequence Similarities : | Contains 1 CCHC-type zinc finger.Contains 1 S1 motif domain. |
Full Length : | Full L. |
Gene Name | ZCCHC17 zinc finger, CCHC domain containing 17 [ Homo sapiens ] |
Official Symbol | ZCCHC17 |
Synonyms | ZCCHC17; zinc finger, CCHC domain containing 17; nucleolar protein of 40 kDa; HSPC251; pNO40; PS1D; |
Gene ID | 51538 |
mRNA Refseq | NM_016505 |
Protein Refseq | NP_057589 |
Uniprot ID | Q9NP64 |
Chromosome Location | 1p35.2 |
Function | RNA binding; metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
GTF2A1-2739R | Recombinant Rat GTF2A1 Protein | +Inquiry |
CD59-543H | Recombinant Human CD59 Protein, His (Fc)-Avi-tagged | +Inquiry |
METAP2-635H | Active Recombinant Human METAP2, His-tagged | +Inquiry |
RFL13654SF | Recombinant Full Length Shewanella Halifaxensis Cobalamin Synthase(Cobs) Protein, His-Tagged | +Inquiry |
LIF-39H | Active Recombinant Human LIF Protein | +Inquiry |
◆ Native Proteins | ||
Cry1Ac-524 | Native Bacillus thuringiensis Cry1Ac Protein | +Inquiry |
CST3-8100H | Native Human Cystatin C (Cystatin 3) | +Inquiry |
PLD-17S | Active Native Streptomyces chromofuscus Phospholipase D | +Inquiry |
GLDH-213B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
F9-5405M | Native Mouse Coagulation Factor IX | +Inquiry |
◆ Cell & Tissue Lysates | ||
PKN1-1363HCL | Recombinant Human PKN1 cell lysate | +Inquiry |
EGFL6-001HCL | Recombinant Human EGFL6 cell lysate | +Inquiry |
UCP2-525HCL | Recombinant Human UCP2 293 Cell Lysate | +Inquiry |
Ileum-247H | Human Ileum Lysate | +Inquiry |
KLK10-4904HCL | Recombinant Human KLK10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZCCHC17 Products
Required fields are marked with *
My Review for All ZCCHC17 Products
Required fields are marked with *
0
Inquiry Basket