Recombinant Human ZCCHC17, His-tagged

• Cat.No.: ZCCHC17-31651TH
• Product Overview: Recombinant full length Human ZCCHC17 with an N terminal His tag; 264 amino acids with the tag, predicted mwt: 30 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 241 amino acids
• Description: ZCCHC17, also known as pNO40 or PS1D, is a 241 amino acid protein that interacts with both Pinin and the 60S ribosomal subunit.
• Conjugation: HIS
• Molecular Weight: 30.000kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, 0.1mM PMSF, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKKKKHKKKHKE
• Sequence Similarities: Contains 1 CCHC-type zinc finger.Contains 1 S1 motif domain.

Gene Information

• Gene Name: ZCCHC17 zinc finger, CCHC domain containing 17 [ Homo sapiens ]
• Official Symbol: ZCCHC17
• Synonyms: ZCCHC17; zinc finger, CCHC domain containing 17; nucleolar protein of 40 kDa; HSPC251; pNO40; PS1D
• Gene ID: 51538
• mRNA Refseq: NM_016505
• Protein Refseq: NP_057589
• Uniprot ID: Q9NP64
• Chromosome Location: 1p35.2
• Function: RNA binding; metal ion binding; zinc ion binding