Recombinant Human ZBTB7B Protein, GST-tagged

• Cat.No.: ZBTB7B-21H
• Product Overview: Human ZBTB7B partial ORF ( NP_056956.1, 433 a.a. - 537 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a zinc finger-containing transcription factor that acts as a key regulator of lineage commitment of immature T-cell precursors. It is necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. It also functions as a transcriptional repressor of type I collagen genes. Alternatively spliced transcript variants have been found for this gene.
• Molecular Mass: 37.29 kDa
• AA Sequence: HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAFPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ZBTB7B zinc finger and BTB domain containing 7B [ Homo sapiens (human) ]
• Official Symbol: ZBTB7B
• Synonyms: ZBTB7B; zinc finger and BTB domain containing 7B; CKROX; THPOK; ZFP67; ZBTB15; ZFP-67; c-KROX; hcKROX; ZNF857B; zinc finger and BTB domain-containing protein 7B; T-helper-inducing POZ/Krueppel-like factor; krueppel-related zinc finger protein cKrox; zinc finger and BTB domain containing 15; zinc finger protein 67 homolog; zinc finger protein 857B; zinc finger protein Th-POK
• Gene ID: 51043
• mRNA Refseq: NM_015872
• Protein Refseq: NP_056956
• MIM: 607646
• UniProt ID: O15156