Recombinant Human ZBTB16 Protein, His tagged
Cat.No. : | ZBTB16-001H |
Product Overview : | Recombinant human zinc finger and BTB domain containing 16 Protein (1-254aa) with N His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-254aa |
Description : | This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. |
Tag : | N-His |
Molecular Mass : | 28.6 kDa |
AA Sequence : | MHHHHHHDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQ |
Endotoxin : | < 0.1 EU/μg by LAL |
Purity : | > 95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH 7.4 |
Concentration : | 1.0 mg/mL |
Gene Name | ZBTB16 zinc finger and BTB domain containing 16 [ Homo sapiens (human) ] |
Official Symbol | ZBTB16 |
Synonyms | ZBTB16; zinc finger and BTB domain containing 16; zinc finger protein 145 (Kruppel like, expressed in promyelocytic leukemia) , ZNF145; zinc finger and BTB domain-containing protein 16; PLZF; zinc finger protein PLZF; zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia); ZNF145; |
Gene ID | 7704 |
mRNA Refseq | NM_001018011 |
Protein Refseq | NP_001018011 |
MIM | 176797 |
UniProt ID | Q05516 |
◆ Recombinant Proteins | ||
Zbtb16-7049M | Recombinant Mouse Zbtb16 Protein, Myc/DDK-tagged | +Inquiry |
ZBTB16-001H | Recombinant Human ZBTB16 Protein, His tagged | +Inquiry |
ZBTB16-5253R | Recombinant Rhesus monkey ZBTB16 Protein, His-tagged | +Inquiry |
ZBTB16-2383H | Recombinant Human ZBTB16 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZBTB16-706HFL | Recombinant Full Length Human ZBTB16 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZBTB16-741HCL | Recombinant Human ZBTB16 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZBTB16 Products
Required fields are marked with *
My Review for All ZBTB16 Products
Required fields are marked with *
0
Inquiry Basket