Recombinant Human ZBTB16 Protein, His tagged

• Cat.No.: ZBTB16-001H
• Product Overview: Recombinant human zinc finger and BTB domain containing 16 Protein (1-254aa) with N His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-254aa
• Description: This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized.
• Tag: N-His
• Molecular Mass: 28.6 kDa
• AA Sequence: MHHHHHHDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQ
• Endotoxin: < 0.1 EU/μg by LAL
• Purity: > 95% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH 7.4
• Concentration: 1.0 mg/mL

Gene Information

• Gene Name: ZBTB16 zinc finger and BTB domain containing 16 [ Homo sapiens (human) ]
• Official Symbol: ZBTB16
• Synonyms: ZBTB16; zinc finger and BTB domain containing 16; zinc finger protein 145 (Kruppel like, expressed in promyelocytic leukemia) , ZNF145; zinc finger and BTB domain-containing protein 16; PLZF; zinc finger protein PLZF; zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia); ZNF145
• Gene ID: 7704
• mRNA Refseq: NM_001018011
• Protein Refseq: NP_001018011
• MIM: 176797
• UniProt ID: Q05516