Recombinant Human ZBTB16 protein, His-tagged
Cat.No. : | ZBTB16-3639H |
Product Overview : | Recombinant Human ZBTB16 protein(394-667 aa), fused to His tag, was expressed in E. coli. |
Availability | March 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 394-667 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHRQTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ZBTB16 zinc finger and BTB domain containing 16 [ Homo sapiens ] |
Official Symbol | ZBTB16 |
Synonyms | ZBTB16; zinc finger and BTB domain containing 16; zinc finger protein 145 (Kruppel like, expressed in promyelocytic leukemia) , ZNF145; zinc finger and BTB domain-containing protein 16; PLZF; zinc finger protein PLZF; zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia); ZNF145; |
Gene ID | 7704 |
mRNA Refseq | NM_001018011 |
Protein Refseq | NP_001018011 |
MIM | 176797 |
UniProt ID | Q05516 |
◆ Recombinant Proteins | ||
ZBTB16-5066R | Recombinant Rhesus Macaque ZBTB16 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZBTB16-5544H | Recombinant Human ZBTB16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZBTB16-001H | Recombinant Human ZBTB16 Protein, His tagged | +Inquiry |
ZBTB16-3639H | Recombinant Human ZBTB16 protein, His-tagged | +Inquiry |
ZBTB16-2383H | Recombinant Human ZBTB16 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZBTB16-741HCL | Recombinant Human ZBTB16 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZBTB16 Products
Required fields are marked with *
My Review for All ZBTB16 Products
Required fields are marked with *
0
Inquiry Basket