Recombinant Human YY1 Protein, His-tagged

• Cat.No.: YY1-630H
• Product Overview: Recombinant Human YY1 fused with His tag at C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
• Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4.
• Molecular Mass: 12.6kD
• AA Sequence: MVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGLEHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: YY1 YY1 transcription factor [ Homo sapiens ]
• Official Symbol: YY1
• Synonyms: YY1; YY1 transcription factor; transcriptional repressor protein YY1; DELTA; INO80 complex subunit S; INO80S; NF E1; UCRBP; Yin and Yang 1 protein; YIN YANG 1; YY-1; delta transcription factor; NF-E1; YIN-YANG-1
• Gene ID: 7528
• mRNA Refseq: NM_003403
• Protein Refseq: NP_003394
• MIM: 600013
• UniProt ID: P25490