Recombinant Human YY1

Cat.No. : YY1-31565TH
Product Overview : Recombinant fragment amino acids 221-320 of Human YY1 with a proprietary tag at N-terminal: predicted molecular weight 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters.YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH
Sequence Similarities : Belongs to the YY transcription factor family.Contains 4 C2H2-type zinc fingers.
Gene Name YY1 YY1 transcription factor [ Homo sapiens ]
Official Symbol YY1
Synonyms YY1; YY1 transcription factor; transcriptional repressor protein YY1; DELTA; INO80 complex subunit S; INO80S; NF E1; UCRBP; Yin and Yang 1 protein; YIN YANG 1;
Gene ID 7528
mRNA Refseq NM_003403
Protein Refseq NP_003394
MIM 600013
Uniprot ID P25490
Chromosome Location 14q
Pathway Delta-Notch Signaling Pathway, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; Signaling events mediated by HDAC Class I, organism-specific biosystem;
Function DNA binding; RNA binding; four-way junction DNA binding; metal ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All YY1 Products

Required fields are marked with *

My Review for All YY1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon