Recombinant Human YY1

• Cat.No.: YY1-31565TH
• Product Overview: Recombinant fragment amino acids 221-320 of Human YY1 with a proprietary tag at N-terminal: predicted molecular weight 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 100 amino acids
• Description: YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters.YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH
• Sequence Similarities: Belongs to the YY transcription factor family.Contains 4 C2H2-type zinc fingers.

Gene Information

• Gene Name: YY1 YY1 transcription factor [ Homo sapiens ]
• Official Symbol: YY1
• Synonyms: YY1; YY1 transcription factor; transcriptional repressor protein YY1; DELTA; INO80 complex subunit S; INO80S; NF E1; UCRBP; Yin and Yang 1 protein; YIN YANG 1
• Gene ID: 7528
• mRNA Refseq: NM_003403
• Protein Refseq: NP_003394
• MIM: 600013
• Uniprot ID: P25490
• Chromosome Location: 14q
• Pathway: Delta-Notch Signaling Pathway, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; Signaling events mediated by HDAC Class I, organism-specific biosystem
• Function: DNA binding; RNA binding; four-way junction DNA binding; metal ion binding; protein binding