Recombinant Human YWHAQ Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: YWHAQ-4572H
• Product Overview: YWHAQ MS Standard C13 and N15-labeled recombinant protein (NP_006817) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.
• Molecular Mass: 27.8 kDa
• AA Sequence: MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAENTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: YWHAQ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [ Homo sapiens (human) ]
• Official Symbol: YWHAQ
• Synonyms: YWHAQ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide; 14-3-3 protein theta; 14 3 3; HS1; protein tau; 14-3-3 protein tau; 14-3-3 protein T-cell; 1C5; 14-3-3
• Gene ID: 10971
• mRNA Refseq: NM_006826
• Protein Refseq: NP_006817
• MIM: 609009
• UniProt ID: P27348