Recombinant Human YWHAQ, His-tagged

• Cat.No.: YWHAQ-26016TH
• Product Overview: Recombinant full length protein corresponding to amino acids 1-245 of Human 14-3-3 Tau, with an N-terminal His(6) tag. Residue M35 of the fusion protein is equivalent to M1 of the native protein.The His(6) tag is located at residues 5 - 10.Protease cleava

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 245 amino acids
• Description: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5 UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.
• Conjugation: HIS
• Molecular Weight: 31.000kDa inclusive of tags
• Tissue specificity: Abundantly expressed in brain, heart and pancreas, and at lower levels in kidney and placenta. Up-regulated in the lumbar spinal cord from patients with sporadic amyotrophic lateral sclerosis (ALS) compared with controls, with highest levels of expression
• Form: Liquid
• Purity: Purified via His tag
• Storage buffer: pH: 7.50Constituents:0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.004% PMSF, 0.012% Benzamidine
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMEKTEL IQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSV AYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKV ESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYF RYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPI RLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTL NEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
• Sequence Similarities: Belongs to the 14-3-3 family.

Gene Information

• Gene Name: YWHAQ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide [ Homo sapiens ]
• Official Symbol: YWHAQ
• Synonyms: YWHAQ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide; 14-3-3 protein theta; 14 3 3; HS1; protein tau
• Gene ID: 10971
• mRNA Refseq: NM_006826
• Protein Refseq: NP_006817
• MIM: 609009
• Uniprot ID: P27348
• Chromosome Location: 2p25.2-p25.1
• Pathway: Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem
• Function: protein N-terminus binding; protein binding; protein domain specific binding