Recombinant Human YWHAQ, His-tagged
Cat.No. : | YWHAQ-26016TH |
Product Overview : | Recombinant full length protein corresponding to amino acids 1-245 of Human 14-3-3 Tau, with an N-terminal His(6) tag. Residue M35 of the fusion protein is equivalent to M1 of the native protein.The His(6) tag is located at residues 5 - 10.Protease cleava |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 245 amino acids |
Description : | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5 UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease. |
Conjugation : | HIS |
Molecular Weight : | 31.000kDa inclusive of tags |
Tissue specificity : | Abundantly expressed in brain, heart and pancreas, and at lower levels in kidney and placenta. Up-regulated in the lumbar spinal cord from patients with sporadic amyotrophic lateral sclerosis (ALS) compared with controls, with highest levels of expression |
Form : | Liquid |
Purity : | Purified via His tag |
Storage buffer : | pH: 7.50Constituents:0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.004% PMSF, 0.012% Benzamidine |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMEKTEL IQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSV AYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKV ESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYF RYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPI RLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTL NEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN |
Sequence Similarities : | Belongs to the 14-3-3 family. |
Gene Name | YWHAQ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide [ Homo sapiens ] |
Official Symbol | YWHAQ |
Synonyms | YWHAQ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide; 14-3-3 protein theta; 14 3 3; HS1; protein tau; |
Gene ID | 10971 |
mRNA Refseq | NM_006826 |
Protein Refseq | NP_006817 |
MIM | 609009 |
Uniprot ID | P27348 |
Chromosome Location | 2p25.2-p25.1 |
Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem; |
Function | protein N-terminus binding; protein binding; protein domain specific binding; |
◆ Recombinant Proteins | ||
YWHAQ-26019TH | Recombinant Human YWHAQ | +Inquiry |
YWHAQ-13H | Recombinant Human Tyrosine 3-monooxygenase/ Tryptophan 5-monooxygenase Activation Protein, Theta Polypeptide | +Inquiry |
YWHAQ-6297R | Recombinant Rat YWHAQ Protein, His (Fc)-Avi-tagged | +Inquiry |
YWHAQ-26017TH | Recombinant Human YWHAQ | +Inquiry |
Ywhaq-7043M | Recombinant Mouse Ywhaq Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAQ-230HCL | Recombinant Human YWHAQ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YWHAQ Products
Required fields are marked with *
My Review for All YWHAQ Products
Required fields are marked with *
0
Inquiry Basket