Recombinant Human YBX1, GST-tagged

Cat.No. : YBX1-4839H
Product Overview : Human YBX1 full-length ORF (1 a.a. - 324 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-324 aa
Description : Y box binding protein 1 also known as Y-box transcription factor or nuclease-sensitive element-binding protein 1 is a protein that in humans is encoded by the YBX1 gene.
Molecular Mass : 62.3 kDa
AA Sequence : MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFI NRNDTKEDVFVHQTA IKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYP RRRGPPRNYQQNYQNSESGEKNEGSESAPEG QAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADN QGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDE TQGQQPPQRRYRRNFNYRRRRPENPKP QDGKETKAADPPAENSSAPEAEQGGAE
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name YBX1 Y box binding protein 1 [ Homo sapiens (human) ]
Official Symbol YBX1
Synonyms YBX1; YB1; BP-8; CSDB; DBPB; YB-1; CSDA2; NSEP1; NSEP-1; MDR-NF1; Y box binding protein 1; nuclease-sensitive element-binding protein 1; CBF-A; EFI-A; DNA-binding protein B; Y-box-binding protein 1; Y-box transcription factor; enhancer factor I subunit A; nuclease sensitive element binding protein 1; CCAAT-binding transcription factor I subunit A; major histocompatibility complex, class II, Y box-binding protein I
Gene ID 4904
mRNA Refseq NM_004559
Protein Refseq NP_004550
MIM 154030
UniProt ID P67809
Chromosome Location 1p34
Pathway BDNF signaling pathway; Processing of Capped Intron-Containing Pre-mRNA; SIDS Susceptibility Pathways
Function double-stranded DNA binding; protein binding; sequence-specific DNA binding transcription factor activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All YBX1 Products

Required fields are marked with *

My Review for All YBX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon