Recombinant Human YAP1 protein, His-tagged

• Cat.No.: YAP1-32H
• Product Overview: Recombinant Human YAP1 protein(206-379 aa), fused with His Tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 206-379 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: YAP1 Yes-associated protein 1 [ Homo sapiens ]
• Official Symbol: YAP1
• Synonyms: YAP1; Yes-associated protein 1; Yes associated protein 1, 65kDa; yorkie homolog; YAP65; yes-associated protein 2; yes-associated protein beta; yes-associated protein delta; 65 kDa Yes-associated protein; YAP; YKI; YAP2
• Gene ID: 10413
• mRNA Refseq: NM_001130145
• Protein Refseq: NP_001123617
• MIM: 606608
• UniProt ID: P46937