Recombinant Human YAP1 protein, GST-tagged

• Cat.No.: YAP1-18H
• Product Overview: Recombinant Human YAP1(1 a.a. - 504 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-504 a.a.
• Description: This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 80.9 kDa
• AA Sequence: MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNP KTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSG PAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMM NSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNS NQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELR TMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPG TNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: YAP1 Yes-associated protein 1 [ Homo sapiens ]
• Official Symbol: YAP1
• Synonyms: YAP1; Yes-associated protein 1; Yes associated protein 1, 65kDa; yorkie homolog; YAP65; yes-associated protein 2; yes-associated protein beta; yes-associated protein delta; 65 kDa Yes-associated protein; YAP; YKI; YAP2
• Gene ID: 10413
• mRNA Refseq: NM_001130145
• Protein Refseq: NP_001123617
• MIM: 606608
• UniProt ID: P46937
• Chromosome Location: 11q13
• Pathway: ErbB4 signaling events, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Gene expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Nuclear signaling by ERBB4, organism-specific biosystem;
• Function: protein binding; transcription coactivator activity; transcription corepressor activity; transcription regulatory region DNA binding