Recombinant Human XRCC4, His-tagged

Cat.No. : XRCC4-30134TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-334 of Human XRCC4 with N terminal His tag, Predicted MWt 39 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-334 a.a.
Description : The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. The non-homologous end-joining pathway is required both for normal development and for suppression of tumors. This gene functionally complements XR-1 Chinese hamster ovary cell mutant, which is impaired in DNA double-strand breaks produced by ionizing radiation and restriction enzymes. Alternative transcription initiation and alternative splicing generates several transcript variants.
Conjugation : HIS
Tissue specificity : Widely expressed.
Form : Lyophilised:Reconstitute with 91 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGH SAWTGTVSESEISQEADDMAMEKGKYVGELRKALLSGA GPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKV ENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRD WNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSL HNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDES TDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSR KRRQRMQRNLGTEPKMAPQENQLQEKEKPDSSLPETSK KEHISAENMSLETLRNSSPEDLFDEI
Sequence Similarities : Belongs to the XRCC4 family.
Full Length : Full L.
Gene Name XRCC4 X-ray repair complementing defective repair in Chinese hamster cells 4 [ Homo sapiens ]
Official Symbol XRCC4
Synonyms XRCC4; X-ray repair complementing defective repair in Chinese hamster cells 4; DNA repair protein XRCC4; X ray repair; complementing defective; repair in Chinese hamster;
Gene ID 7518
mRNA Refseq NM_022550
Protein Refseq NP_072044
MIM 194363
Uniprot ID Q13426
Chromosome Location 5q14.2
Pathway 2-LTR circle formation, organism-specific biosystem; DNA Repair, organism-specific biosystem; Double-Strand Break Repair, organism-specific biosystem; Early Phase of HIV Life Cycle, organism-specific biosystem; HIV Infection, organism-specific biosystem;
Function NOT DNA binding; NOT ligase activity; protein C-terminus binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All XRCC4 Products

Required fields are marked with *

My Review for All XRCC4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon