Recombinant Human XRCC4, His-tagged

• Cat.No.: XRCC4-30134TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-334 of Human XRCC4 with N terminal His tag, Predicted MWt 39 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-334 a.a.
• Description: The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. The non-homologous end-joining pathway is required both for normal development and for suppression of tumors. This gene functionally complements XR-1 Chinese hamster ovary cell mutant, which is impaired in DNA double-strand breaks produced by ionizing radiation and restriction enzymes. Alternative transcription initiation and alternative splicing generates several transcript variants.
• Conjugation: HIS
• Tissue specificity: Widely expressed.
• Form: Lyophilised:Reconstitute with 91 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGH SAWTGTVSESEISQEADDMAMEKGKYVGELRKALLSGA GPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKV ENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRD WNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSL HNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDES TDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSR KRRQRMQRNLGTEPKMAPQENQLQEKEKPDSSLPETSK KEHISAENMSLETLRNSSPEDLFDEI
• Sequence Similarities: Belongs to the XRCC4 family.
• Full Length: Full L.

Gene Information

• Gene Name: XRCC4 X-ray repair complementing defective repair in Chinese hamster cells 4 [ Homo sapiens ]
• Official Symbol: XRCC4
• Synonyms: XRCC4; X-ray repair complementing defective repair in Chinese hamster cells 4; DNA repair protein XRCC4; X ray repair; complementing defective; repair in Chinese hamster
• Gene ID: 7518
• mRNA Refseq: NM_022550
• Protein Refseq: NP_072044
• MIM: 194363
• Uniprot ID: Q13426
• Chromosome Location: 5q14.2
• Pathway: 2-LTR circle formation, organism-specific biosystem; DNA Repair, organism-specific biosystem; Double-Strand Break Repair, organism-specific biosystem; Early Phase of HIV Life Cycle, organism-specific biosystem; HIV Infection, organism-specific biosystem
• Function: NOT DNA binding; NOT ligase activity; protein C-terminus binding; protein binding