Recombinant Human XPO5 protein, GST-tagged
Cat.No. : | XPO5-5765H |
Product Overview : | Recombinant Human XPO5 protein(1-100 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-100 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQLVRMLTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMKHEDV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | XPO5 |
Synonyms | XPO5; exportin 5; exportin-5; KIAA1291; ran-binding protein 21; exp5; FLJ14239; FLJ32057; FLJ45606; |
Gene ID | 57510 |
mRNA Refseq | NM_020750 |
Protein Refseq | NP_065801 |
MIM | 607845 |
UniProt ID | Q9HAV4 |
◆ Recombinant Proteins | ||
XPO5-2368H | Recombinant Human XPO5 Protein, His (Fc)-Avi-tagged | +Inquiry |
XPO5-5765H | Recombinant Human XPO5 protein, GST-tagged | +Inquiry |
XPO5-1404H | Recombinant Human XPO5 protein, His & T7-tagged | +Inquiry |
XPO5-2819H | Recombinant Human XPO5 protein, His-tagged | +Inquiry |
XPO5-6081H | Recombinant Human XPO5 Protein (Ala2-Gln180), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XPO5-1938HCL | Recombinant Human XPO5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XPO5 Products
Required fields are marked with *
My Review for All XPO5 Products
Required fields are marked with *
0
Inquiry Basket