Recombinant Human XPO5 protein, His-tagged

Source :	E. coli
Species :	Human
Tag :	His
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Protein length :	1-100 aa
AA Sequence :	MRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQLVRMLTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMKHEDV
Purity :	85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Name	XPO5 exportin 5 [ Homo sapiens ]
Official Symbol	XPO5
Synonyms	XPO5; exportin 5; exportin-5; KIAA1291; ran-binding protein 21; exp5; FLJ14239; FLJ32057; FLJ45606;
Gene ID	57510
mRNA Refseq	NM_020750
Protein Refseq	NP_065801
MIM	607845
UniProt ID	Q9HAV4